Lineage for d1d2fb_ (1d2f B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589557Protein Modulator in mal gene expression, MalY [53408] (1 species)
  7. 589558Species Escherichia coli [TaxId:562] [53409] (1 PDB entry)
  8. 589560Domain d1d2fb_: 1d2f B: [34412]

Details for d1d2fb_

PDB Entry: 1d2f (more details), 2.5 Å

PDB Description: x-ray structure of maly from escherichia coli: a pyridoxal-5'-phosphate-dependent enzyme acting as a modulator in mal gene expression

SCOP Domain Sequences for d1d2fb_:

Sequence, based on SEQRES records: (download)

>d1d2fb_ c.67.1.3 (B:) Modulator in mal gene expression, MalY {Escherichia coli}
fdfskvvdrhgtwctqwdyvadrfgtadllpftisdmdfatapciiealnqrlmhgvfgy
srwkndeflaaiahwfstqhytaidsqtvvygpsviymvselirqwsetgegvvihtpay
dafykaiegnqrtvmpvalekqadgwfcdmgkleavlakpeckimllcspqnptgkvwtc
deleimadlcerhgvrvisdeihmdmvwgeqphipwsnvargdwalltsgsksfnipalt
gaygiiensssrdaylsalkgrdglsspsvlaltahiaayqqgapwldalriylkdnlty
iadkmnaafpelnwqipqstylawldlrplniddnalqkalieqekvaimpgytygeegr
gfvrlnagcprsklekgvaglinairavr

Sequence, based on observed residues (ATOM records): (download)

>d1d2fb_ c.67.1.3 (B:) Modulator in mal gene expression, MalY {Escherichia coli}
fdfskvvllpftisdmdfatapciiealnqrlmhgvfgysrwkndeflaaiahwfstqhy
taidsqtvvygpsviymvselirqwsetgegvvihtpaydafykaiegnqrtvmpvalek
qadgwfcdmgkleavlakpeckimllcspqnptgkvwtcdeleimadlcerhgvrvisde
ihmdmvwgeqphipwsnvargdwalltsgsksfnipaltgaygiiensssrdaylsalkg
rdglsspsvlaltahiaayqqgapwldalriylkdnltyiadkmnaafpelnwqipqsty
lawldlrplniddnalqkalieqekvaimpgytygeegrgfvrlnagcprsklekgvagl
inairavr

SCOP Domain Coordinates for d1d2fb_:

Click to download the PDB-style file with coordinates for d1d2fb_.
(The format of our PDB-style files is described here.)

Timeline for d1d2fb_: