Lineage for d4ilga2 (4ilg A:155-355)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334634Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2334635Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 protein domains)
  6. 2334636Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2334637Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (5 PDB entries)
  8. 2334642Domain d4ilga2: 4ilg A:155-355 [343965]
    Other proteins in same PDB: d4ilga1, d4ilgb1, d4ilgb2, d4ilgc_
    automated match to d4i43a2
    complexed with epe

Details for d4ilga2

PDB Entry: 4ilg (more details), 2.1 Å

PDB Description: Crystal structure of Aar2p in complex with the Prp8p RNaseH and Jab1/MPN domains
PDB Compounds: (A:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d4ilga2:

Sequence, based on SEQRES records: (download)

>d4ilga2 a.118.29.1 (A:155-355) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sssdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfa
flnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillner
vwniclyssfqknslhntekimenkypellgkdneddaliygisdeerddeddehnptiv
gglyyqrp

Sequence, based on observed residues (ATOM records): (download)

>d4ilga2 a.118.29.1 (A:155-355) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sssdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfa
flnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillner
vwniclyssfqknslhntekimenkypellddehnptivgglyyqrp

SCOPe Domain Coordinates for d4ilga2:

Click to download the PDB-style file with coordinates for d4ilga2.
(The format of our PDB-style files is described here.)

Timeline for d4ilga2:

  • d4ilga2 is new in SCOPe 2.07-stable