SCOPe 2.08: Domain d3vrqa3: 3vrq A:11-147

Lineage for d3vrqa3 (3vrq A:11-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families)
   automatically mapped to Pfam PF02262

5. Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)

6. Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries)

8. Domain d3vrqa3: 3vrq A:11-147 [343883]
   Other proteins in same PDB: d3vrqa1, d3vrqa2, d3vrqb1, d3vrqb2
   complexed with ca; mutant

Details for d3vrqa3

PDB Entry: 3vrq, 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)

PDB Compounds: (A:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqa3:

Sequence, based on SEQRES records:

>d3vrqa3 a.48.1.1 (A:11-147) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
qweearalgravrmlqrleeqcvdprlsvsppslrdllprtaqllrevahsrraaggggp
ggpggsgdflliylanleaksrqvaallpprgrrsandelfragsrlrrqlaklaiifsh
mhaelhalfpggkycgh

Sequence, based on observed residues (ATOM records):

>d3vrqa3 a.48.1.1 (A:11-147) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
qweearalgravrmlqrleeqcppslrdllprtaqllrevahsrpggpggsgdflliyla
nleaksrqvaalsrlrrqlaklaiifshmhaelhalfpggkycgh

Timeline for d3vrqa3:

• d3vrqa3 first appeared in SCOPe 2.07