Lineage for d1vsyb_ (1vsy B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2554873Domain d1vsyb_: 1vsy B: [343590]
    Other proteins in same PDB: d1vsy1_, d1vsy2_, d1vsya_, d1vsyc_, d1vsyd_, d1vsyf_, d1vsyg_, d1vsyh1, d1vsyh2, d1vsyi_, d1vsyj_, d1vsyk_, d1vsyl_, d1vsym_, d1vsyn_, d1vsyo_, d1vsyq_, d1vsyr_, d1vsyt_, d1vsyu_, d1vsyv1, d1vsyv2, d1vsyw_, d1vsyx_, d1vsyy_, d1vsyz_
    automated match to d5l64k_

Details for d1vsyb_

PDB Entry: 1vsy (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (B:) Proteasome component Y7

SCOPe Domain Sequences for d1vsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsyb_ d.153.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qidyaltavkqgvtslgikatngvviatekksssplamsetlskvslltpdigavysgmg
pdyrvlvdksrkvahtsykriygeypptkllvsevakimqeatqsggvrpfgvslliagh
defngfslyqvdpsgsyfpwkataigkgsvaaktflekrwndeleledaihialltlkes
vegefngdtielaiigdenpdllgytgiptdkgprfrkltsqeindrleal

SCOPe Domain Coordinates for d1vsyb_:

Click to download the PDB-style file with coordinates for d1vsyb_.
(The format of our PDB-style files is described here.)

Timeline for d1vsyb_:

  • d1vsyb_ is new in SCOPe 2.07-stable