Lineage for d6ap4o3 (6ap4 O:261-381)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540275Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2540276Protein automated matches [226907] (20 species)
    not a true protein
  7. 2540277Species Acinetobacter baumannii [TaxId:470] [342941] (1 PDB entry)
  8. 2540322Domain d6ap4o3: 6ap4 O:261-381 [343383]
    Other proteins in same PDB: d6ap4a4, d6ap4b4, d6ap4c4, d6ap4d4, d6ap4e4, d6ap4f4, d6ap4g4, d6ap4h4, d6ap4i4, d6ap4j4, d6ap4l4, d6ap4m4, d6ap4n4, d6ap4o4, d6ap4p4
    automated match to d4tr8a3
    complexed with mg

Details for d6ap4o3

PDB Entry: 6ap4 (more details), 2.95 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from acinetobacter baumannii
PDB Compounds: (O:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6ap4o3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ap4o3 d.131.1.0 (O:261-381) automated matches {Acinetobacter baumannii [TaxId: 470]}
rrviprggdkhvlighdvfkqslqrvailsneklrgvflnfnqdslqlrannpeqdeaie
dlaiqyqsaplemsfnaqylldvlgvldgddvnmsmteanqsvlvqdpahpdqtyvvmpm
r

SCOPe Domain Coordinates for d6ap4o3:

Click to download the PDB-style file with coordinates for d6ap4o3.
(The format of our PDB-style files is described here.)

Timeline for d6ap4o3:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ap4a1, d6ap4a2, d6ap4a3, d6ap4a4, d6ap4b1, d6ap4b2, d6ap4b3, d6ap4b4, d6ap4c1, d6ap4c2, d6ap4c3, d6ap4c4, d6ap4d1, d6ap4d2, d6ap4d3, d6ap4d4, d6ap4e1, d6ap4e2, d6ap4e3, d6ap4e4, d6ap4f1, d6ap4f2, d6ap4f3, d6ap4f4, d6ap4g1, d6ap4g2, d6ap4g3, d6ap4g4, d6ap4h1, d6ap4h2, d6ap4h3, d6ap4h4, d6ap4i1, d6ap4i2, d6ap4i3, d6ap4i4, d6ap4j1, d6ap4j2, d6ap4j3, d6ap4j4, d6ap4k1, d6ap4k2, d6ap4k3, d6ap4l1, d6ap4l2, d6ap4l3, d6ap4l4, d6ap4m1, d6ap4m2, d6ap4m3, d6ap4m4, d6ap4n1, d6ap4n2, d6ap4n3, d6ap4n4, d6ap4p1, d6ap4p2, d6ap4p3, d6ap4p4