Lineage for d6ap4c2 (6ap4 C:121-260)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977233Species Acinetobacter baumannii [TaxId:470] [342941] (1 PDB entry)
  8. 2977241Domain d6ap4c2: 6ap4 C:121-260 [343378]
    Other proteins in same PDB: d6ap4a4, d6ap4b4, d6ap4c4, d6ap4d4, d6ap4e4, d6ap4f4, d6ap4g4, d6ap4h4, d6ap4i4, d6ap4j4, d6ap4l4, d6ap4m4, d6ap4n4, d6ap4o4, d6ap4p4
    automated match to d4tr8a2
    complexed with mg

Details for d6ap4c2

PDB Entry: 6ap4 (more details), 2.95 Å

PDB Description: crystal structure of the dna polymerase iii subunit beta from acinetobacter baumannii
PDB Compounds: (C:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d6ap4c2:

Sequence, based on SEQRES records: (download)

>d6ap4c2 d.131.1.0 (C:121-260) automated matches {Acinetobacter baumannii [TaxId: 470]}
llttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdghr
lalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtintpsrdke
qgditvrfttklidgkfpdy

Sequence, based on observed residues (ATOM records): (download)

>d6ap4c2 d.131.1.0 (C:121-260) automated matches {Acinetobacter baumannii [TaxId: 470]}
llttensqgtqvqvtqrelkrlfektafamavqdvrfyltgtlleidenqlravttdghr
lalceilasstssqlvqaivprkavgelqrllsiedeqltlligrellnvtindkeqgdi
tvrfttklidgkfpdy

SCOPe Domain Coordinates for d6ap4c2:

Click to download the PDB-style file with coordinates for d6ap4c2.
(The format of our PDB-style files is described here.)

Timeline for d6ap4c2:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ap4a1, d6ap4a2, d6ap4a3, d6ap4a4, d6ap4b1, d6ap4b2, d6ap4b3, d6ap4b4, d6ap4d1, d6ap4d2, d6ap4d3, d6ap4d4, d6ap4e1, d6ap4e2, d6ap4e3, d6ap4e4, d6ap4f1, d6ap4f2, d6ap4f3, d6ap4f4, d6ap4g1, d6ap4g2, d6ap4g3, d6ap4g4, d6ap4h1, d6ap4h2, d6ap4h3, d6ap4h4, d6ap4i1, d6ap4i2, d6ap4i3, d6ap4i4, d6ap4j1, d6ap4j2, d6ap4j3, d6ap4j4, d6ap4k1, d6ap4k2, d6ap4k3, d6ap4l1, d6ap4l2, d6ap4l3, d6ap4l4, d6ap4m1, d6ap4m2, d6ap4m3, d6ap4m4, d6ap4n1, d6ap4n2, d6ap4n3, d6ap4n4, d6ap4o1, d6ap4o2, d6ap4o3, d6ap4o4, d6ap4p1, d6ap4p2, d6ap4p3, d6ap4p4