Lineage for d5uboa2 (5ubo A:147-375)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122053Protein Actin [53073] (8 species)
  7. 2122079Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (63 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2300074Domain d5uboa2: 5ubo A:147-375 [343375]
    Other proteins in same PDB: d5ubos_
    automated match to d1ijjb2
    complexed with atp, ca, mpd

Details for d5uboa2

PDB Entry: 5ubo (more details), 2.39 Å

PDB Description: mical-oxidized actin complex with gelsolin segment 1
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d5uboa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uboa2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d5uboa2:

Click to download the PDB-style file with coordinates for d5uboa2.
(The format of our PDB-style files is described here.)

Timeline for d5uboa2:

  • d5uboa2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5uboa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5ubos_