Lineage for d5wk3a_ (5wk3 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175656Protein automated matches [190403] (3 species)
    not a true protein
  7. 2175657Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries)
  8. 2175671Domain d5wk3a_: 5wk3 A: [343370]
    Other proteins in same PDB: d5wk3p1, d5wk3p2, d5wk3r1, d5wk3r2, d5wk3t1, d5wk3t2, d5wk3v1, d5wk3v2
    automated match to d1nr4e_
    complexed with gol

Details for d5wk3a_

PDB Entry: 5wk3 (more details), 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab
PDB Compounds: (A:) C-C motif chemokine 17

SCOPe Domain Sequences for d5wk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wk3a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknavkylqsl
er

SCOPe Domain Coordinates for d5wk3a_:

Click to download the PDB-style file with coordinates for d5wk3a_.
(The format of our PDB-style files is described here.)

Timeline for d5wk3a_: