Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries) |
Domain d5wk3a_: 5wk3 A: [343370] Other proteins in same PDB: d5wk3p1, d5wk3p2, d5wk3r1, d5wk3r2, d5wk3t1, d5wk3t2, d5wk3v1, d5wk3v2 automated match to d1nr4e_ complexed with gol |
PDB Entry: 5wk3 (more details), 1.9 Å
SCOPe Domain Sequences for d5wk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wk3a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eccleyfkgaiplrklktwyqtsedcsrdaivfvtvqgraicsdpnnkrvknavkylqsl er
Timeline for d5wk3a_: