Lineage for d5wyqb1 (5wyq B:5-250)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150174Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2150175Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2150238Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 protein domains)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 2150251Protein automated matches [196235] (2 species)
    not a true protein
  7. 2299975Species Pseudomonas aeruginosa [TaxId:208963] [343276] (2 PDB entries)
  8. 2300063Domain d5wyqb1: 5wyq B:5-250 [343364]
    Other proteins in same PDB: d5wyqa2, d5wyqb2
    automated match to d1p9pa_
    complexed with sam

Details for d5wyqb1

PDB Entry: 5wyq (more details), 2.16 Å

PDB Description: crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa
PDB Compounds: (B:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d5wyqb1:

Sequence, based on SEQRES records: (download)

>d5wyqb1 c.116.1.4 (B:5-250) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
lwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggpgm
vmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryegid
erfieehvdeewsigdyvlsggelpamvlvdavtrllpgalghadsaeedsftdglldcp
hytrpevyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllae
yirqrd

Sequence, based on observed residues (ATOM records): (download)

>d5wyqb1 c.116.1.4 (B:5-250) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
lwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggpgm
vmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryegid
erfieehvdeewsigdyvlsggelpamvlvdavtrllpgaldsftdglldcphytrpevy
adkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd

SCOPe Domain Coordinates for d5wyqb1:

Click to download the PDB-style file with coordinates for d5wyqb1.
(The format of our PDB-style files is described here.)

Timeline for d5wyqb1:

  • d5wyqb1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5wyqb2