Lineage for d5xhgb2 (5xhg B:121-220)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2300047Species Escherichia coli [TaxId:316407] [343348] (1 PDB entry)
  8. 2300062Domain d5xhgb2: 5xhg B:121-220 [343363]
    Other proteins in same PDB: d5xhga1, d5xhga2, d5xhgb1, d5xhgc1, d5xhgc2, d5xhgd1
    automated match to d1n8zb2
    complexed with edo, oaz, peg, so4

Details for d5xhgb2

PDB Entry: 5xhg (more details), 1.76 Å

PDB Description: crystal structure of trastuzumab fab fragment bearing ne-(o- azidobenzyloxycarbonyl)-l-lysine
PDB Compounds: (B:) polypeptide(H)

SCOPe Domain Sequences for d5xhgb2:

Sequence, based on SEQRES records: (download)

>d5xhgb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 316407]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d5xhgb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Escherichia coli [TaxId: 316407]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d5xhgb2:

Click to download the PDB-style file with coordinates for d5xhgb2.
(The format of our PDB-style files is described here.)

Timeline for d5xhgb2:

  • d5xhgb2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21