Lineage for d5xh3a_ (5xh3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (91 species)
    not a true protein
  7. 2299971Species Ideonella sakaiensis [TaxId:1547922] [343272] (5 PDB entries)
  8. 2300060Domain d5xh3a_: 5xh3 A: [343361]
    automated match to d4eb0a_
    complexed with 856, gol, so4; mutant

Details for d5xh3a_

PDB Entry: 5xh3 (more details), 1.3 Å

PDB Description: crystal structure of a novel pet hydrolase r103g/s131a mutant in complex with hemt from ideonella sakaiensis 201-f6
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d5xh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xh3a_ c.69.1.0 (A:) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalgqvaslngtssspiygkv
dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
tfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d5xh3a_:

Click to download the PDB-style file with coordinates for d5xh3a_.
(The format of our PDB-style files is described here.)

Timeline for d5xh3a_:

  • d5xh3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21