Lineage for d5xt5a1 (5xt5 A:1-404)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (124 species)
    not a true protein
  7. 2472284Species Bacillus subtilis [TaxId:224308] [320074] (2 PDB entries)
  8. 2472286Domain d5xt5a1: 5xt5 A:1-404 [343357]
    Other proteins in same PDB: d5xt5a2, d5xt5c_, d5xt5d_
    automated match to d4lw2a_
    complexed with plp, zn

Details for d5xt5a1

PDB Entry: 5xt5 (more details), 2.34 Å

PDB Description: sufs-sufu complex from bacillus subtilis
PDB Compounds: (A:) Cysteine desulfurase SufS

SCOPe Domain Sequences for d5xt5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xt5a1 c.67.1.0 (A:1-404) automated matches {Bacillus subtilis [TaxId: 224308]}
mnitdireqfpilhqqvnghdlvyldsaatsqkpravietldkyynqynsnvhrgvhtlg
tratdgyegarekvrkfinaksmaeiiftkgtttslnmvalsyaranlkpgdevvityme
hhaniipwqqavkatgatlkyiplqedgtisledvretvtsntkivavshvsnvlgtvnp
ikemakiahdngavivvdgaqstphmkidvqdldcdffalsshkmcgptgvgvlygkkal
lenmepaefggemidfvglyestwkelpwkfeagtpiiagaiglgaaidfleeigldeis
rhehklaayalerfrqldgvtvygpeeraglvtfnlddvhphdvatvldaegiavraghh
caqplmkwldvtatarasfylynteeeidklvealqktkeyftn

SCOPe Domain Coordinates for d5xt5a1:

Click to download the PDB-style file with coordinates for d5xt5a1.
(The format of our PDB-style files is described here.)

Timeline for d5xt5a1: