Lineage for d5yxca_ (5yxc A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396418Family b.60.1.4: Hypothetical protein YodA [101863] (2 protein domains)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2396419Protein Hypothetical protein YodA [101864] (3 species)
  7. 2396422Species Escherichia coli [TaxId:562] [101865] (6 PDB entries)
    Uniprot P76344
  8. 2396427Domain d5yxca_: 5yxc A: [343343]
    automated match to d1s7da_
    complexed with cit, zn

Details for d5yxca_

PDB Entry: 5yxc (more details), 1.76 Å

PDB Description: crystal structure of zinc binding protein zint in complex with citrate from e. coli
PDB Compounds: (A:) metal-binding protein zint

SCOPe Domain Sequences for d5yxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxca_ b.60.1.4 (A:) Hypothetical protein YodA {Escherichia coli [TaxId: 562]}
gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
veemmsh

SCOPe Domain Coordinates for d5yxca_:

Click to download the PDB-style file with coordinates for d5yxca_.
(The format of our PDB-style files is described here.)

Timeline for d5yxca_: