Lineage for d5y9va_ (5y9v A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2054099Superfamily b.42.6: MIR domain [82109] (3 families) (S)
  5. 2054107Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 protein domains)
    Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5
  6. 2054123Protein automated matches [254610] (2 species)
    not a true protein
  7. 2300019Species Plutella xylostella [TaxId:51655] [343320] (1 PDB entry)
  8. 2300040Domain d5y9va_: 5y9v A: [343341]
    automated match to d3hsma_
    complexed with cl, gol

Details for d5y9va_

PDB Entry: 5y9v (more details), 2.84 Å

PDB Description: crystal sturcture of diamondback moth ryanodine receptor n-terminal domain
PDB Compounds: (A:) Ryanodine receptor 1

SCOPe Domain Sequences for d5y9va_:

Sequence, based on SEQRES records: (download)

>d5y9va_ b.42.6.2 (A:) automated matches {Plutella xylostella [TaxId: 51655]}
vsflrtedmvclsctatgervclaaegfgnrhcfleniqdknippdlsqcvfvieqalsv
ralqelvtaagsetgkgtgsghrtllygnaillrhlnsdmylaclstsssqdklafdvgl
qehsqgeacwwtlhpaskqrsegekvrvgddlilvsvaterylhttkenevsivnasfhv
thwsvqpyg

Sequence, based on observed residues (ATOM records): (download)

>d5y9va_ b.42.6.2 (A:) automated matches {Plutella xylostella [TaxId: 51655]}
vsflrtedmvclsctatgervclaaegfgnrhcfleniqdknippdlsqcvfvieqalsv
ralqelvtghrtllygnaillrhlnsdmylaclstsssqdklafdvglqehsqgeacwwt
lhpaskqrsegekvrvgddlilvsvaterylhttkenevsivnasfhvthwsvqpyg

SCOPe Domain Coordinates for d5y9va_:

Click to download the PDB-style file with coordinates for d5y9va_.
(The format of our PDB-style files is described here.)

Timeline for d5y9va_:

  • d5y9va_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21