SCOPe 2.06: Domain d5ujta1: 5ujt A:0-81

Lineage for d5ujta1 (5ujt A:0-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5ujta1: 5ujt A:0-81 [343339]
   Other proteins in same PDB: d5ujta2, d5ujtb1, d5ujtb2, d5ujtd2, d5ujte1, d5ujte2, d5ujtg2, d5ujth1, d5ujth2
   automated match to d4z7ua1
   complexed with nag

Details for d5ujta1

PDB Entry: 5ujt, 1.94 Å

PDB Description: crystal structure of human hla-dq8 in complex with insulin mimotope binding in register 3

PDB Compounds: (A:) MHC class II antigen

SCOPe Domain Sequences for d5ujta1:

Sequence; same for both SEQRES and ATOM records:

>d5ujta1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
altniavlkhnlncvikrsnsta

Timeline for d5ujta1:

• d5ujta1 is new in SCOPe 2.06-stable
  
• d5ujta1 appears in SCOPe 2.07
  
• d5ujta1 appears in the current release, SCOPe 2.08