Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5ujta1: 5ujt A:0-81 [343339] Other proteins in same PDB: d5ujta2, d5ujtb1, d5ujtb2, d5ujtd2, d5ujte1, d5ujte2, d5ujtg2, d5ujth1, d5ujth2 automated match to d4z7ua1 complexed with nag |
PDB Entry: 5ujt (more details), 1.94 Å
SCOPe Domain Sequences for d5ujta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ujta1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf altniavlkhnlncvikrsnsta
Timeline for d5ujta1: