SCOPe 2.06: Domain d5wk3p1: 5wk3 P:1-112

Lineage for d5wk3p1 (5wk3 P:1-112)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5wk3p1: 5wk3 P:1-112 [343327]
   Other proteins in same PDB: d5wk3a_, d5wk3b_, d5wk3c_, d5wk3d_, d5wk3p2, d5wk3r2, d5wk3t2, d5wk3v2
   automated match to d1dn0a1
   complexed with gol

Details for d5wk3p1

PDB Entry: 5wk3, 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab

PDB Compounds: (P:) m116 light chain

SCOPe Domain Sequences for d5wk3p1:

Sequence; same for both SEQRES and ATOM records:

>d5wk3p1 b.1.1.0 (P:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvllspwnsnqlawyqqkpgqppklliygastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyylipstfgqgtkvei

Timeline for d5wk3p1:

• d5wk3p1 is new in SCOPe 2.06-stable
  
• d5wk3p1 appears in SCOPe 2.07
  
• d5wk3p1 appears in the current release, SCOPe 2.08