Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries) |
Domain d5ujtb1: 5ujt B:3-94 [343318] Other proteins in same PDB: d5ujta1, d5ujta2, d5ujtb2, d5ujtd1, d5ujtd2, d5ujte2, d5ujtg1, d5ujtg2, d5ujth2 automated match to d1jk8b2 complexed with nag |
PDB Entry: 5ujt (more details), 1.94 Å
SCOPe Domain Sequences for d5ujtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ujtb1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]} spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn sqkevlertraeldtvcrhnyqlelrttlqrr
Timeline for d5ujtb1: