Lineage for d5xafd2 (5xaf D:246-441)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (56 PDB entries)
  8. 2525693Domain d5xafd2: 5xaf D:246-441 [343312]
    Other proteins in same PDB: d5xafa1, d5xafb1, d5xafc1, d5xafd1, d5xafe_, d5xaff1, d5xaff2
    automated match to d3rycd2
    complexed with 84f, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5xafd2

PDB Entry: 5xaf (more details), 2.55 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound z1 complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xafd2:

Sequence, based on SEQRES records: (download)

>d5xafd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5xafd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5xafd2:

Click to download the PDB-style file with coordinates for d5xafd2.
(The format of our PDB-style files is described here.)

Timeline for d5xafd2: