SCOPe 2.06: Domain d5w6gb_: 5w6g B:

Lineage for d5w6gb_ (5w6g B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343308] (1 PDB entry)

8. Domain d5w6gb_: 5w6g B: [343309]
   Other proteins in same PDB: d5w6ga1, d5w6ga2, d5w6gl1, d5w6gl2
   automated match to d5bnyf_
   complexed with gol, nag, so4

Details for d5w6gb_

PDB Entry: 5w6g, 2.79 Å

PDB Description: human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5w6gb_:

Sequence; same for both SEQRES and ATOM records:

>d5w6gb_ h.3.1.0 (B:) automated matches {Influenza a virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]}
aiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntqft
avgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlyekvks
qlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrek

Timeline for d5w6gb_:

• d5w6gb_ is new in SCOPe 2.06-stable
  
• d5w6gb_ appears in SCOPe 2.07
  
• d5w6gb_ appears in the current release, SCOPe 2.08