Lineage for d5w6gb_ (5w6g B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (23 species)
    not a true protein
  7. 2300007Species Influenza a virus (a/solomon islands/3/2006(h1n1)) [TaxId:464623] [343308] (1 PDB entry)
  8. 2300008Domain d5w6gb_: 5w6g B: [343309]
    Other proteins in same PDB: d5w6ga1, d5w6ga2, d5w6gl1, d5w6gl2
    automated match to d5bnyf_
    complexed with gol, nag, so4

Details for d5w6gb_

PDB Entry: 5w6g (more details), 2.79 Å

PDB Description: human antibody 6649 in complex with influenza hemagglutinin h1 solomon islands
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5w6gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w6gb_ h.3.1.0 (B:) automated matches {Influenza a virus (a/solomon islands/3/2006(h1n1)) [TaxId: 464623]}
aiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntqft
avgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlyekvks
qlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrek

SCOPe Domain Coordinates for d5w6gb_:

Click to download the PDB-style file with coordinates for d5w6gb_.
(The format of our PDB-style files is described here.)

Timeline for d5w6gb_:

  • d5w6gb_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21