Lineage for d5ybwb_ (5ybw B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2481051Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2481052Protein automated matches [190215] (32 species)
    not a true protein
  7. 2481240Species Scapharca broughtonii [TaxId:148819] [343306] (1 PDB entry)
  8. 2481242Domain d5ybwb_: 5ybw B: [343307]
    automated match to d3l6cb_

Details for d5ybwb_

PDB Entry: 5ybw (more details), 1.9 Å

PDB Description: crystal structure of pyridoxal 5'-phosphate-dependent aspartate racemase
PDB Compounds: (B:) aspartate racemase

SCOPe Domain Sequences for d5ybwb_:

Sequence, based on SEQRES records: (download)

>d5ybwb_ c.79.1.0 (B:) automated matches {Scapharca broughtonii [TaxId: 148819]}
ipqfevtvtdikkaydriskhilytpvftsptfdrmvgskagrqfyfkaenlqktgsfka
rgalnailcalerepslagvvthssgnhgqalawaskragvkccvvvpktapqvkfdame
nygaevvkcepnptsrketceglaksrgykyisssddydviagqgtialellqqqpdlda
ilvsvsaggmasgicvytkntksdlkvflvepegkmleeciskrerlwpnppqfldtiad
giilqqcgnktwpiilelpekevitvnndniveamrfvfarmklvieaaagatvaaamte
rfqnfhpeakkvgiilcggnvdieklpwt

Sequence, based on observed residues (ATOM records): (download)

>d5ybwb_ c.79.1.0 (B:) automated matches {Scapharca broughtonii [TaxId: 148819]}
ipqfevtvtdikkaydriskhilytpvftsptfdrmvgskagrqfyfkaenlqktgsfka
rgalnailcalerepslagvvthssgnhgqalawaskragvkccvvvpktapqvkfdame
nygaevvkcetsrketceglksrgykyisssddydviagqgtialellqqqpdldailvs
vsaggmasgicvytkntksdlkvflvepegkmleeciskrerlwpnppqfldtiadgiil
qqcgnktwpiilelpekevitvnndniveamrfvfarmklvieaaagatvaaamterfqn
fhpeakkvgiilcggnvdieklpwt

SCOPe Domain Coordinates for d5ybwb_:

Click to download the PDB-style file with coordinates for d5ybwb_.
(The format of our PDB-style files is described here.)

Timeline for d5ybwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ybwa_