Lineage for d5y2ob1 (5y2o B:207-474)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (113 PDB entries)
    Uniprot P37231 232-505
  8. 2299999Domain d5y2ob1: 5y2o B:207-474 [343300]
    Other proteins in same PDB: d5y2ob2
    automated match to d2xkwa_
    complexed with 8n6

Details for d5y2ob1

PDB Entry: 5y2o (more details), 1.8 Å

PDB Description: structure of ppargamma ligand binding domain-pioglitazone complex
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d5y2ob1:

Sequence, based on SEQRES records: (download)

>d5y2ob1 a.123.1.1 (B:207-474) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d5y2ob1 a.123.1.1 (B:207-474) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgspfviydmnslmmgedkikfkhitkev
airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
ktethpllqeiyk

SCOPe Domain Coordinates for d5y2ob1:

Click to download the PDB-style file with coordinates for d5y2ob1.
(The format of our PDB-style files is described here.)

Timeline for d5y2ob1:

  • d5y2ob1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5y2ob2
View in 3D
Domains from other chains:
(mouse over for more information)
d5y2oa_