Lineage for d5wk3t1 (5wk3 T:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032718Domain d5wk3t1: 5wk3 T:1-112 [343290]
    Other proteins in same PDB: d5wk3a_, d5wk3b_, d5wk3c_, d5wk3d_, d5wk3p2, d5wk3r2, d5wk3t2, d5wk3v2
    automated match to d1dn0a1
    complexed with gol

Details for d5wk3t1

PDB Entry: 5wk3 (more details), 1.9 Å

PDB Description: crystal structure of the complex between ccl17 and m116 fab
PDB Compounds: (T:) m116 light chain

SCOPe Domain Sequences for d5wk3t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wk3t1 b.1.1.0 (T:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvllspwnsnqlawyqqkpgqppklliygastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyylipstfgqgtkvei

SCOPe Domain Coordinates for d5wk3t1:

Click to download the PDB-style file with coordinates for d5wk3t1.
(The format of our PDB-style files is described here.)

Timeline for d5wk3t1: