Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d5xafe_: 5xaf E: [343271] Other proteins in same PDB: d5xafa1, d5xafa2, d5xafb1, d5xafb2, d5xafc1, d5xafc2, d5xafd1, d5xafd2, d5xaff1, d5xaff2 automated match to d4i55e_ complexed with 84f, acp, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5xaf (more details), 2.55 Å
SCOPe Domain Sequences for d5xafe_:
Sequence, based on SEQRES records: (download)
>d5xafe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5xafe_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5xafe_: