Lineage for d5vfja1 (5vfj A:3-133)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2338958Protein Snake phospholipase A2 [48624] (38 species)
  7. 2338992Species Bothrops pauloensis [TaxId:1042543] [343230] (4 PDB entries)
  8. 2338995Domain d5vfja1: 5vfj A:3-133 [343251]
    Other proteins in same PDB: d5vfja2, d5vfjb2
    automated match to d1pa0a_
    complexed with dhc, so4

Details for d5vfja1

PDB Entry: 5vfj (more details), 2.08 Å

PDB Description: crystal structure of bnsp-7 from bothrops pauloensis complexed with caffeic acid
PDB Compounds: (A:) Basic phospholipase A2 homolog BnSP-7

SCOPe Domain Sequences for d5vfja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfja1 a.133.1.2 (A:3-133) Snake phospholipase A2 {Bothrops pauloensis [TaxId: 1042543]}
felgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpkkd
rysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadpc

SCOPe Domain Coordinates for d5vfja1:

Click to download the PDB-style file with coordinates for d5vfja1.
(The format of our PDB-style files is described here.)

Timeline for d5vfja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vfja2