Lineage for d5ubos_ (5ubo S:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534203Family d.109.1.1: Gelsolin-like [55754] (5 protein domains)
  6. 2534204Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2534221Species Human (Homo sapiens) [TaxId:9606] [55761] (40 PDB entries)
    Uniprot P20065 55-179
  8. 2534283Domain d5ubos_: 5ubo S: [343246]
    Other proteins in same PDB: d5uboa1, d5uboa2
    automated match to d1p8zg_
    complexed with atp, ca, mpd

Details for d5ubos_

PDB Entry: 5ubo (more details), 2.39 Å

PDB Description: mical-oxidized actin complex with gelsolin segment 1
PDB Compounds: (S:) gelsolin

SCOPe Domain Sequences for d5ubos_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ubos_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgfkh

SCOPe Domain Coordinates for d5ubos_:

Click to download the PDB-style file with coordinates for d5ubos_.
(The format of our PDB-style files is described here.)

Timeline for d5ubos_: