Lineage for d5w3ud_ (5w3u D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084960Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2084961Protein automated matches [190150] (26 species)
    not a true protein
  7. 2085109Species Sulfolobus solfataricus [TaxId:2287] [188418] (12 PDB entries)
  8. 2299943Domain d5w3ud_: 5w3u D: [343244]
    automated match to d2vc7a_
    complexed with co, edo, fe, gol; mutant

Details for d5w3ud_

PDB Entry: 5w3u (more details), 2.5 Å

PDB Description: crystal structure of ssopox asb5 mutant (v27a-i76t-y97w-y99f-l130p- l226v)
PDB Compounds: (D:) aryldialkylphosphatase

SCOPe Domain Sequences for d5w3ud_:

Sequence, based on SEQRES records: (download)

>d5w3ud_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrafseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdtrfmekvvkatginlvagtgiwifidlpfyflnrsideiadlfih
dikegiqgtpnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygvdlflpvdkrnettl
rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

Sequence, based on observed residues (ATOM records): (download)

>d5w3ud_ c.1.9.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrafseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdtrfmekvvkatginlvagtgiwifidlpfyflnrsideiadlfih
dikegiqgtpnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygvdlflpvdkrnettl
rlikdgysdkimishdycsitlifedtipflkrngvneeviatifkenpkkffs

SCOPe Domain Coordinates for d5w3ud_:

Click to download the PDB-style file with coordinates for d5w3ud_.
(The format of our PDB-style files is described here.)

Timeline for d5w3ud_:

  • d5w3ud_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21