Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5w6gl2: 5w6g L:114-215 [343239] Other proteins in same PDB: d5w6ga1, d5w6ga2, d5w6gb_, d5w6gl1 automated match to d1aqkl2 complexed with gol, nag, so4 |
PDB Entry: 5w6g (more details), 2.79 Å
SCOPe Domain Sequences for d5w6gl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w6gl2 b.1.1.2 (L:114-215) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d5w6gl2: