SCOPe 2.08: Domain d5vfma1: 5vfm A:3-133

Lineage for d5vfma1 (5vfm A:3-133)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Bothrops pauloensis [TaxId:1042543] [343230] (4 PDB entries)

8. Domain d5vfma1: 5vfm A:3-133 [343236]
   Other proteins in same PDB: d5vfma2, d5vfmb2
   automated match to d1pa0a_
   complexed with hc4, me2, so4

Details for d5vfma1

PDB Entry: 5vfm, 2.06 Å

PDB Description: crystal structure of bnsp-7 from bothrops pauloensis complexed with p- coumaric acid

PDB Compounds: (A:) Basic phospholipase A2 homolog BnSP-7

SCOPe Domain Sequences for d5vfma1:

Sequence; same for both SEQRES and ATOM records:

>d5vfma1 a.133.1.2 (A:3-133) Snake phospholipase A2 {Bothrops pauloensis [TaxId: 1042543]}
felgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpkkd
rysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadpc

Timeline for d5vfma1:

• d5vfma1 first appeared in SCOPe 2.06
  
• d5vfma1 appears in SCOPe 2.07