Lineage for d5u94a_ (5u94 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2546162Species Mycobacterium tuberculosis [TaxId:83332] [343222] (1 PDB entry)
  8. 2546163Domain d5u94a_: 5u94 A: [343223]
    automated match to d1mrub_
    complexed with g93, gol, mg

Details for d5u94a_

PDB Entry: 5u94 (more details), 2.2 Å

PDB Description: crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693.
PDB Compounds: (A:) serine/threonine-protein kinase pknb

SCOPe Domain Sequences for d5u94a_:

Sequence, based on SEQRES records: (download)

>d5u94a_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
lsadldavvlkalaknpenryqtaaemradlvrvhn

Sequence, based on observed residues (ATOM records): (download)

>d5u94a_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiigtaqylspeqargdsvda
rsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkal
aknpenryqtaaemradlvrvhn

SCOPe Domain Coordinates for d5u94a_:

Click to download the PDB-style file with coordinates for d5u94a_.
(The format of our PDB-style files is described here.)

Timeline for d5u94a_: