![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
![]() | Protein automated matches [190150] (26 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [188418] (16 PDB entries) |
![]() | Domain d5w3uc_: 5w3u C: [343220] automated match to d2vc7a_ complexed with co, edo, fe, gol; mutant |
PDB Entry: 5w3u (more details), 2.5 Å
SCOPe Domain Sequences for d5w3uc_:
Sequence, based on SEQRES records: (download)
>d5w3uc_ c.1.9.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mriplvgkdsieskdigftlihehlrafseavrqqwphlynedeefrnavnevkramqfg vktivdptvmglgrdtrfmekvvkatginlvagtgiwifidlpfyflnrsideiadlfih dikegiqgtpnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygvdlflpvdkrnettl rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev iatifkenpkkffs
>d5w3uc_ c.1.9.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mriplvgkdsieskdigftlihehlrafseavrqqwphlynedeefrnavnevkramqfg vktivdptvmglgrdtrfmekvvkatginlvagtgiwifidlpfyflnrsideiadlfih dikegiqgtpnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygvvdkrnettlrlikd gysdkimishdycsitlifedtipflkrngvneeviatifkenpkkffs
Timeline for d5w3uc_: