Lineage for d5mlga1 (5mlg A:7-381)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (11 species)
    not a true protein
  7. 2299915Species Rattus norvegicus [TaxId:10116] [343216] (1 PDB entry)
  8. 2299916Domain d5mlga1: 5mlg A:7-381 [343217]
    Other proteins in same PDB: d5mlga2
    automated match to d4amta_
    complexed with nag

Details for d5mlga1

PDB Entry: 5mlg (more details), 2.6 Å

PDB Description: crystal structure of rat prorenin
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d5mlga1:

Sequence, based on SEQRES records: (download)

>d5mlga1 b.50.1.0 (A:7-381) automated matches {Rattus norvegicus [TaxId: 10116]}
sfgrillkkmpsvreileergvdmtrisaewgefikkssftnvtspvvltnyldtqyyge
igigtpsqtfkvifdtgsanlwvpstkcgplytaceihnlydssesssymengteftihy
gsgkvkgflsqdvvtvggiivtqtfgevtelplipfmlakfdgvlgmgfpaqavdgvipv
fdhilsqrvlkeevfsvyysreshllggevvlggsdpqhyqgnfhyvsiskagswqitmk
gvsvgpatllceegcmavvdtgtsyisgptsslqlimqalgvkekrannyvvncsqvptl
pdisfylggrtytlsnmdyvqknpfrnddlcilalqgldippptgpvwvlgatfirkfyt
efdrhnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d5mlga1 b.50.1.0 (A:7-381) automated matches {Rattus norvegicus [TaxId: 10116]}
sfgrillkkmpsvreileergvdmtrisaewgefikspvvltnyldtqyygeigigtpsq
tfkvifdtgsanlwvpstkcgplytaceihnlydssesssymengteftihygsgkvkgf
lsqdvvtvggiivtqtfgevtelplipfmlakfdgvlgmgfpaqavdgvipvfdhilsqr
vlkeevfsvyysreshllggevvlggsdpqhyqgnfhyvsiskagswqitmkgvsvgpat
llceegcmavvdtgtsyisgptsslqlimqalgvkekrannyvvncsqvptlpdisfylg
grtytlsnmdyvqknpfcilalqgldippptgpvwvlgatfirkfytefdrhnnrigfal
ar

SCOPe Domain Coordinates for d5mlga1:

Click to download the PDB-style file with coordinates for d5mlga1.
(The format of our PDB-style files is described here.)

Timeline for d5mlga1:

  • d5mlga1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5mlga2