Lineage for d5oska1 (5osk A:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121690Protein automated matches [226837] (7 species)
    not a true protein
  7. 2121696Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)
  8. 2121758Domain d5oska1: 5osk A:1-245 [343202]
    Other proteins in same PDB: d5oska2, d5oskb2, d5oskc2, d5oskd2, d5oske_, d5oskf1, d5oskf2
    automated match to d4ihja1
    complexed with a9q, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5oska1

PDB Entry: 5osk (more details), 2.11 Å

PDB Description: tubulin-7j complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5oska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oska1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5oska1:

Click to download the PDB-style file with coordinates for d5oska1.
(The format of our PDB-style files is described here.)

Timeline for d5oska1: