Lineage for d5v3qa2 (5v3q A:103-241)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996914Protein Class omega GST [81352] (1 species)
  7. 1996915Species Human (Homo sapiens) [TaxId:9606] [47632] (2 PDB entries)
  8. 2299900Domain d5v3qa2: 5v3q A:103-241 [343201]
    Other proteins in same PDB: d5v3qa1
    automated match to d1eema1
    complexed with mlx, so4

Details for d5v3qa2

PDB Entry: 5v3q (more details), 2.25 Å

PDB Description: human gsto1-1 complexed with ml175
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d5v3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v3qa2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

SCOPe Domain Coordinates for d5v3qa2:

Click to download the PDB-style file with coordinates for d5v3qa2.
(The format of our PDB-style files is described here.)

Timeline for d5v3qa2:

  • d5v3qa2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5v3qa1