Lineage for d5mmeb1 (5mme B:1081-1197)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992368Family a.29.2.1: Bromodomain [47371] (5 protein domains)
  6. 1992403Protein automated matches [190366] (2 species)
    not a true protein
  7. 1992404Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)
  8. 2299893Domain d5mmeb1: 5mme B:1081-1197 [343194]
    Other proteins in same PDB: d5mmea2, d5mmeb2
    automated match to d4nyva_
    complexed with 8q6

Details for d5mmeb1

PDB Entry: 5mme (more details), 1.35 Å

PDB Description: crystal structure of crebbp bromodomain complexd with us46c
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d5mmeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmeb1 a.29.2.1 (B:1081-1197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5mmeb1:

Click to download the PDB-style file with coordinates for d5mmeb1.
(The format of our PDB-style files is described here.)

Timeline for d5mmeb1:

  • d5mmeb1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-21

View in 3D
Domains from same chain:
(mouse over for more information)
d5mmeb2