SCOPe 2.06: Domain d5o9la1: 5o9l A:1-172

Lineage for d5o9la1 (5o9l A:1-172)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site
   automatically mapped to Pfam PF00838

6. Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117337] (4 PDB entries)
   Uniprot P13693

8. Domain d5o9la1: 5o9l A:1-172 [343191]
   Other proteins in same PDB: d5o9la2, d5o9lb2
   automated match to d1h6qa_

Details for d5o9la1

PDB Entry: 5o9l, 1.75 Å

PDB Description: crystal structure of human histamine-releasing factor (hrf/tctp)

PDB Compounds: (A:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d5o9la1:

Sequence, based on SEQRES records:

>d5o9la1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records):

>d5o9la1 b.88.1.2 (A:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegtestvitgvdivmnhhlqe
tsftkeaykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenm
npdgmvalldyredgvtpymiffkdglemekc

Timeline for d5o9la1:

• d5o9la1 is new in SCOPe 2.06-stable
  
• d5o9la1 appears in SCOPe 2.07
  
• d5o9la1 appears in the current release, SCOPe 2.08