Lineage for d5ub9a_ (5ub9 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2487425Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)
  8. 2487428Domain d5ub9a_: 5ub9 A: [343186]
    automated match to d2vd2a_
    complexed with act, cl, zn

Details for d5ub9a_

PDB Entry: 5ub9 (more details), 1.9 Å

PDB Description: catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5ub9a_:

Sequence, based on SEQRES records: (download)

>d5ub9a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqare

Sequence, based on observed residues (ATOM records): (download)

>d5ub9a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfnlkdfegl
riatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlkev
kviyesracliqkenalskekqalvdkimlrvagvmqare

SCOPe Domain Coordinates for d5ub9a_:

Click to download the PDB-style file with coordinates for d5ub9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ub9a_: