SCOPe 2.08: Domain d5ub9a_: 5ub9 A:

Lineage for d5ub9a_ (5ub9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)

8. Domain d5ub9a_: 5ub9 A: [343186]
   automated match to d2vd2a_
   complexed with act, cl, zn

Details for d5ub9a_

PDB Entry: 5ub9, 1.9 Å

PDB Description: catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni

PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d5ub9a_:

Sequence, based on SEQRES records:

>d5ub9a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqare

Sequence, based on observed residues (ATOM records):

>d5ub9a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfnlkdfegl
riatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlkev
kviyesracliqkenalskekqalvdkimlrvagvmqare

Timeline for d5ub9a_:

• d5ub9a_ first appeared in SCOPe 2.06
  
• d5ub9a_ appears in SCOPe 2.07