Lineage for d5mlja_ (5mlj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992368Family a.29.2.1: Bromodomain [47371] (5 protein domains)
  6. 1992403Protein automated matches [190366] (2 species)
    not a true protein
  7. 1992404Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)
  8. 2299880Domain d5mlja_: 5mlj A: [343181]
    automated match to d1b91a_
    complexed with 9st, edo

Details for d5mlja_

PDB Entry: 5mlj (more details), 1.8 Å

PDB Description: bromodomain of human gcn5 with 4-bromo-2-methyl-5-(((3r,5r)-1-methyl- 5-phenylpiperidin-3-yl)amino)pyridazin-3(2h)-one
PDB Compounds: (A:) Histone acetyltransferase KAT2A

SCOPe Domain Sequences for d5mlja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlja_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyv
trklfvadlqrviancreynppdseycrcasalekffyfklkegglidk

SCOPe Domain Coordinates for d5mlja_:

Click to download the PDB-style file with coordinates for d5mlja_.
(The format of our PDB-style files is described here.)

Timeline for d5mlja_:

  • d5mlja_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21