Lineage for d5orga_ (5org A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915205Species Agrobacterium tumefaciens [TaxId:1183423] [343144] (1 PDB entry)
  8. 2915206Domain d5orga_: 5org A: [343173]
    automated match to d4pp0b_
    protein/DNA complex; complexed with 6db, act, cl, edo, gol, na

Details for d5orga_

PDB Entry: 5org (more details), 1.99 Å

PDB Description: structure of the periplasmic binding protein (pbp) occj from a. tumefaciens b6 in complex with octopine.
PDB Compounds: (A:) Octopine-binding periplasmic protein

SCOPe Domain Sequences for d5orga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5orga_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 1183423]}
mqeksitiateggyapwnfsgpggkldgfeidlanalcekmkakcqivaqnwdgimpslt
gkkydaimaamsvtpkrqevigfsipyaagingfavmgdsklaempglgetysldsqada
akkaiadissflngttvgvqgsttastfldkyfkgsvdikeyksveehnldltsgrldav
lanatvlaaaiekpemkgaklvgplfsggefgvvavglrkedtalkadfdaaikaasedg
tiktlslkwfkvdvtpq

SCOPe Domain Coordinates for d5orga_:

Click to download the PDB-style file with coordinates for d5orga_.
(The format of our PDB-style files is described here.)

Timeline for d5orga_: