Lineage for d1aicb_ (1aic B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) 
Family c.67.1.1: AAT-like [53384] (3 proteins) Protein Aspartate aminotransferase, AAT [53385] (6 species) 
Species Escherichia coli [TaxId:562] [53390] (49 PDB entries) 
Domain d1aicb_: 1aic B: [34317]
Details for d1aicb_
PDB Entry: 1aic (more details), 2.4 Å
PDB Description: structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue
SCOP Domain Sequences for d1aicb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aicb_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Escherichia coli}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assyshnfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl
SCOP Domain Coordinates for d1aicb_:
Click to download the PDB-style file with coordinates for d1aicb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aicb_:
- d1aicb_ appears in SCOP 1.57
- d1aicb_ appears in the current release, SCOPe 2.08
View in 3D
