Lineage for d5npoa_ (5npo A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2217995Protein beta-Lactamase, class A [56606] (16 species)
  7. 2218026Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)
  8. 2299868Domain d5npoa_: 5npo A: [343169]
    Other proteins in same PDB: d5npob1, d5npob2
    automated match to d1erma_
    complexed with mg

Details for d5npoa_

PDB Entry: 5npo (more details), 1.95 Å

PDB Description: promiscuous protein self-assembly as a function of protein stability
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d5npoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5npoa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d5npoa_:

Click to download the PDB-style file with coordinates for d5npoa_.
(The format of our PDB-style files is described here.)

Timeline for d5npoa_:

  • d5npoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21