Lineage for d5npob1 (5npo B:42-288)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2569281Protein automated matches [190161] (25 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (70 PDB entries)
  8. 2569438Domain d5npob1: 5npo B:42-288 [343158]
    Other proteins in same PDB: d5npoa_, d5npob2
    automated match to d4ibxa_
    complexed with mg

Details for d5npob1

PDB Entry: 5npo (more details), 1.95 Å

PDB Description: promiscuous protein self-assembly as a function of protein stability
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5npob1:

Sequence, based on SEQRES records: (download)

>d5npob1 e.3.1.1 (B:42-288) automated matches {Escherichia coli [TaxId: 562]}
krvgyieldlasgkilvsfrpeerfpmmstfkvllcgavlsrvdagqeqlgrrihysqnd
lveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggpkeltaflhnmgdhvtr
ldrwepelneaipnderdtttpvamattlrklltgelltaasrqqlidwmeadkvagpll
rsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtgsqatmdernrqiaeig
aslikhw

Sequence, based on observed residues (ATOM records): (download)

>d5npob1 e.3.1.1 (B:42-288) automated matches {Escherichia coli [TaxId: 562]}
krvgyieldlasgkilvsfrpeerfpmmstfkvllcgavlsrvdagqeqlgrrihysqnd
lveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggpkeltaflhnmgdhvtr
ldrwepelneerdtttpvamattlrklltgelltaasrqqlidwmealpagwfiadksrg
iiaalgpdgkpsrivviymtgatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d5npob1:

Click to download the PDB-style file with coordinates for d5npob1.
(The format of our PDB-style files is described here.)

Timeline for d5npob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5npob2
View in 3D
Domains from other chains:
(mouse over for more information)
d5npoa_