Lineage for d5oskc2 (5osk C:246-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (61 PDB entries)
  8. 2525584Domain d5oskc2: 5osk C:246-440 [343157]
    Other proteins in same PDB: d5oska1, d5oskb1, d5oskc1, d5oskd1, d5oske_, d5oskf1, d5oskf2, d5oskf3
    automated match to d4i50a2
    complexed with a9q, acp, ca, gdp, gol, gtp, imd, mes, mg

Details for d5oskc2

PDB Entry: 5osk (more details), 2.11 Å

PDB Description: tubulin-7j complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5oskc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oskc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5oskc2:

Click to download the PDB-style file with coordinates for d5oskc2.
(The format of our PDB-style files is described here.)

Timeline for d5oskc2: