Lineage for d5mlna_ (5mln A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (239 species)
    not a true protein
  7. 2299852Species Candida magnoliae [TaxId:5490] [343153] (1 PDB entry)
  8. 2299854Domain d5mlna_: 5mln A: [343155]
    automated match to d3osua_
    complexed with nap, peg

Details for d5mlna_

PDB Entry: 5mln (more details), 1.6 Å

PDB Description: the crystal structure of alcohol dehydrogenase 10 from candida magnoliae
PDB Compounds: (A:) Alcohol dehydrogenase 3

SCOPe Domain Sequences for d5mlna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlna_ c.2.1.0 (A:) automated matches {Candida magnoliae [TaxId: 5490]}
snalvtggsrgigaasaiklaqegynvtlasrsvdklnevkaklpivqdgqkhyiweldl
adveaassfkgaplparsydvfvsnagvaafsptadhddkewqnllavnlsspialtkal
lkdvserpvdkplqiiyissvaglhgaaqvavysaskagldgfmrsvarevgpkgihvns
inpgytktemtagiealpdlpikgwiepeaiadavlflaksknitgtnivvdnglia

SCOPe Domain Coordinates for d5mlna_:

Click to download the PDB-style file with coordinates for d5mlna_.
(The format of our PDB-style files is described here.)

Timeline for d5mlna_:

  • d5mlna_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21