Lineage for d5mlnb_ (5mln B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (244 species)
    not a true protein
  7. 2430883Species Candida magnoliae [TaxId:5490] [343153] (1 PDB entry)
  8. 2430885Domain d5mlnb_: 5mln B: [343154]
    automated match to d3osua_
    complexed with nap, peg

Details for d5mlnb_

PDB Entry: 5mln (more details), 1.6 Å

PDB Description: the crystal structure of alcohol dehydrogenase 10 from candida magnoliae
PDB Compounds: (B:) Alcohol dehydrogenase 3

SCOPe Domain Sequences for d5mlnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mlnb_ c.2.1.0 (B:) automated matches {Candida magnoliae [TaxId: 5490]}
tsnalvtggsrgigaasaiklaqegynvtlasrsvdklnevkaklpivqdgqkhyiweld
ladveaassfkgaplparsydvfvsnagvaafsptadhddkewqnllavnlsspialtka
llkdvserpvdkplqiiyissvaglhgaaqvavysaskagldgfmrsvarevgpkgihvn
sinpgytktemtagiealpdlpikgwiepeaiadavlflaksknitgtnivvdnglia

SCOPe Domain Coordinates for d5mlnb_:

Click to download the PDB-style file with coordinates for d5mlnb_.
(The format of our PDB-style files is described here.)

Timeline for d5mlnb_: