Lineage for d5mina_ (5min A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065559Superfamily b.68.2: Soluble quinoprotein glucose dehydrogenase [50952] (1 family) (S)
  5. 2065560Family b.68.2.1: Soluble quinoprotein glucose dehydrogenase [50953] (2 protein domains)
  6. 2299813Protein automated matches [343114] (1 species)
    not a true protein
  7. 2299814Species Acinetobacter calcoaceticus [TaxId:471] [343115] (1 PDB entry)
  8. 2299845Domain d5mina_: 5min A: [343146]
    automated match to d1crub_
    complexed with ca, cl

Details for d5mina_

PDB Entry: 5min (more details), 1.76 Å

PDB Description: apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
PDB Compounds: (A:) Quinoprotein glucose dehydrogenase B

SCOPe Domain Sequences for d5mina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mina_ b.68.2.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 471]}
dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkalpnqtiirryt
ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
vltdtagnvqkddgsvtntlenpgslikftyk

SCOPe Domain Coordinates for d5mina_:

Click to download the PDB-style file with coordinates for d5mina_.
(The format of our PDB-style files is described here.)

Timeline for d5mina_:

  • d5mina_ appears in periodic updates to SCOPe 2.06 starting on 2017-12-21