Lineage for d5o9mb1 (5o9m B:1-172)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084043Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2084044Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2084054Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
    automatically mapped to Pfam PF00838
  6. 2084055Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 2084059Species Human (Homo sapiens) [TaxId:9606] [117337] (4 PDB entries)
    Uniprot P13693
  8. 2084061Domain d5o9mb1: 5o9m B:1-172 [343139]
    Other proteins in same PDB: d5o9ma2, d5o9mb2
    automated match to d1h6qa_
    complexed with peg

Details for d5o9mb1

PDB Entry: 5o9m (more details), 1.4 Å

PDB Description: crystal structure of human histamine-releasing factor (hrf/tctp) containing a disulphide-linked dimer
PDB Compounds: (B:) Translationally-controlled tumor protein

SCOPe Domain Sequences for d5o9mb1:

Sequence, based on SEQRES records: (download)

>d5o9mb1 b.88.1.2 (B:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpege
gtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaae
qikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc

Sequence, based on observed residues (ATOM records): (download)

>d5o9mb1 b.88.1.2 (B:1-172) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Human (Homo sapiens) [TaxId: 9606]}
miiyrdlishdemfsdiykireiadglclevegkmvsgnasaegpegegtestvitgvdi
vmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfkny
qffigenmnpdgmvalldyredgvtpymiffkdglemekc

SCOPe Domain Coordinates for d5o9mb1:

Click to download the PDB-style file with coordinates for d5o9mb1.
(The format of our PDB-style files is described here.)

Timeline for d5o9mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o9mb2