SCOPe 2.06: Domain d5n88a_: 5n88 A:

Lineage for d5n88a_ (5n88 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d5n88a_: 5n88 A: [343127]
   Other proteins in same PDB: d5n88d_, d5n88e1, d5n88e2
   automated match to d2vyrh_

Details for d5n88a_

PDB Entry: 5n88, 1.7 Å

PDB Description: crystal structure of antibody bound to viral protein

PDB Compounds: (A:) VH59 antibody

SCOPe Domain Sequences for d5n88a_:

Sequence; same for both SEQRES and ATOM records:

>d5n88a_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfstfsmnwvrqapgkglewvsyisrtsktiyy
adsvkgrftisrdnskntlylqmnslraedtavyycarggwalgdeipssflefdywgqg
tlvtvs

Timeline for d5n88a_:

• d5n88a_ is new in SCOPe 2.06-stable
  
• d5n88a_ appears in SCOPe 2.07
  
• d5n88a_ appears in the current release, SCOPe 2.08