Lineage for d5ml0a_ (5ml0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 protein domains)
  6. 2316891Protein automated matches [190366] (2 species)
    not a true protein
  7. 2316974Species Mouse (Mus musculus) [TaxId:10090] [343120] (2 PDB entries)
  8. 2316975Domain d5ml0a_: 5ml0 A: [343121]
    automated match to d1b91a_
    complexed with edo, p2l

Details for d5ml0a_

PDB Entry: 5ml0 (more details), 1.64 Å

PDB Description: bromodomain of mouse pcaf with (r)-4-chloro-2-methyl-5-((1- methylpiperidin-3-yl)amino)pyridazin-3(2h)-one
PDB Compounds: (A:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d5ml0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ml0a_ a.29.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peqlystlknilqqvknhpnawpfmepvkrteapgyyevirfpmdlktmserlrnryyvs
kklfmadlqrvftnckeynppeseyykcasilekfffskikeaglidk

SCOPe Domain Coordinates for d5ml0a_:

Click to download the PDB-style file with coordinates for d5ml0a_.
(The format of our PDB-style files is described here.)

Timeline for d5ml0a_: