Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Methanococcus vannielii [TaxId:406327] [343055] (1 PDB entry) |
Domain d5mkim_: 5mki M: [343112] automated match to d1mgqa_ complexed with ca, epe |
PDB Entry: 5mki (more details), 2.05 Å
SCOPe Domain Sequences for d5mkim_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mkim_ b.38.1.0 (M:) automated matches {Methanococcus vannielii [TaxId: 406327]} dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv rgdnvlyvsl
Timeline for d5mkim_: