Lineage for d5mkim_ (5mki M:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (13 species)
    not a true protein
  7. 2381243Species Methanococcus vannielii [TaxId:406327] [343055] (1 PDB entry)
  8. 2381256Domain d5mkim_: 5mki M: [343112]
    automated match to d1mgqa_
    complexed with ca, epe

Details for d5mkim_

PDB Entry: 5mki (more details), 2.05 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii
PDB Compounds: (M:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mkim_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkim_ b.38.1.0 (M:) automated matches {Methanococcus vannielii [TaxId: 406327]}
dtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlvv
rgdnvlyvsl

SCOPe Domain Coordinates for d5mkim_:

Click to download the PDB-style file with coordinates for d5mkim_.
(The format of our PDB-style files is described here.)

Timeline for d5mkim_: